Biologically Active Peptides: Substrates and Inhibitors

santa cruz biotechnology, inc.

Log In | Hilfe | Inhaltsübersicht

Willkommen! 0 Produkt(e) im Warenkorb. Bestellen

Antikörper & RNAi
Primärantikörper Sekundärantikörper, Kontroll-IgG und Normalsera Phosphorylierungs-spezifische Antikörper Durchflusszytometrie (FCM) Antikörper für die Immunhistochemie auf Paraffinschnitten Protein A, G PLUS und L-Agarose RNAi Produkte: siRNA, shRNA und shRNA Lentivirale Partikel Gewebeextrakte, Zelllysate und Proteine WB Positivkontrollen - Lysate transfizierter Zellen Kits, Puffer, Substrate, Inhibitoren, Supportprodukte Antikörper für die veterinärmedizinische Forschung
Chemikalien
ChemCruz™ Chemikalien Gebrauchsfertige PBS / TBS Puffer Häufig verwendete Laborchemikalien Farbstoffe Lösungsmittel Substrate für AP und HRP
Laborbedarf
Laborbedarf UltraCruz™ ExactaCruz™ CrystalCruz™
Tiergesundheit
Tiergesundheit Angebote & Aktionen Animal Health News Tiergesundheit Pharmacy UltraCruz Supplements
Highlights
Angebote & Aktionen LIF Protein - für die Zellkultur Antikörper für die veterinärmedizinische Forschung Neue monoklonale Antikörper Neue polyklonale Antikörper New Paraffin Staining
Unternehmen
Unternehmen Kontakt Protokolle Produktreferenzen Datenblatt / SDS Technischer Service Katalog bestellen Chromosomen Index Cruz Credits™ Investigator Award Stellenangebote Distributoren

Home » Supportprodukte » Biologically Active Peptides: Substrates and Inhibitors

Biologically Active Peptides: Substrates and Inhibitors

PRODUKT	CATALOG #	DESCRIPTION	AMOUNT
Adenylate Cyclase Activator	sc-3063	Synthetic activator of adenylate cyclases more potent at stimulating adenylate cyclases sequence: HSDGIFTDSYRYRLQMAVKKYLAAVLGKRYLQRVKDK (>97% pure by HPLC)	synthetic activator of adenylate cyclases, 0.5 mg/0.1 ml
Akt substrate	sc-3025	Substrate	n/a
ALLN (peptide)	sc-3089	cyclin degradation. Inhibits Calpain and cathepsin L and B	synthetic inhibitor of calpain, 0.5 mg/0.1 ml
Angiotensin Receptor inhibitor	sc-3062	Inhibitor
ARF inhibitor	sc-3030	Inhibitor
Autocamtide-2 inhibitor	sc-3117		synthetic inhibitor for Autocamtide-2, 0.5 mg/0.1 ml
CaM Kinase II inhibitor	sc-3037		synthetic inhibitor of CaM Kinase II, 0.5 mg/0.1 ml
CaM Kinase II inhibitor	sc-3039		synthetic inhibitor of CaM Kinase II, 0.5 mg/0.1 ml
CaM Kinase II substrate	sc-3119	substrate	synthetic substrate for CaM Kinase II, 0.5 mg/0.1 ml
CaM Kinase II substrate	sc-3029	substrate	synthetic substrate for CaM Kinase II, 0.5 mg/0.1 ml
CaM Kinase II substrate	sc-3118		synthetic substrate for CaM Kinase II, 0.5 mg/0.1 ml
CaM Kinase IV substrate	sc-3028	Substrate	synthetic substrate for CaM Kinase IV, 0.5 mg/0.1 ml
casein kinase I substrate	sc-3120	Substrate	synthetic substrate for casein kinase I, 0.5 mg/0.1 ml
casein kinase II substrate	sc-3046	Substrate	synthetic substrate for casein kinase II, 0.5 mg/0.1 ml
casein kinase II substrate	sc-3121	Substrate	synthetic substrate for casein kinase II, 0.5 mg/0.1 ml
caspase inhibitor II	sc-3068	Ac-VAD-cho, Inhibits caspase-1,3,4,7	Ac-VAD-cho, Inhibits caspase-1,3,4,7, 0.5 mg/0.1 ml
caspase-1 inhibitor	sc-3070	Ac-YVAD-cho, Inhibits caspase-1 and 4	Ac-YVAD-cho, Inhibits caspase-1 and 4, 0.5 mg/0.1 ml
caspase-1 substrate	sc-3058	Substrate	synthetic substrate for caspase-1 and caspase-4, 0.5 mg/0.1 ml
caspase-3 inhibitor	sc-3073	Ac-DEVD-cho, Inhibits caspases-3,6,7,8,10	Ac-DEVD-cho, Inhibits caspases-3,6,7,8,10, 0.5 mg/0.1 ml
caspase-4 inhibitor	sc-3076	Ac-LEVD-cho, Inhibits caspase-4	Ac-LEVD-cho, Inhibits caspase-4, 0.5 mg/0.1 ml
caspase-5 inhibitor	sc-3078	z-WHED-fmk, Inhibits caspase-5	z-WEHD-fmk, Inhibits caspase-5, 0.5 mg/0.1 ml
caspase-8 inhibitor	sc-3082	Ac-IEFD-cho, Inhibits caspase-8 and granzyme B	Ac-IEFD-cho, Inhibits caspase-8 and granzyme B, 0.5 mg/0.1 ml
Cathepsin B inhibitor	sc-3131	Z-FA-FMK	Z-FA-FMK, 0.5 mg
Cathepsin B substrate	sc-3133	Z-RR-AMC	Z-RR-AMC, 0.5 mg
Cathepsin G substrate	sc-3134	Suc-AAPF-pNA, excellent substrate for the quantitative determination of cathepsin G activity	Suc-AAPF-pNA, excellent substrate for the quantitative determination of cathepsin G activity, 0.5 mg
Cathepsin inhibitor peptide	sc-3130	Z-FG-NHO-Bz, selectively inhibits cathepsins B, L, S and papaiⁿ	Z-FG-NHO-Bz, selectively inhibits cathepsins B, L, S and papaiⁿ, 0.5 mg
Cathepsin L inhibitor	sc-3132	Z-FY-CHO, a potent and selective inhibitor of cathepsin L	Z-FY-CHO, a potent and selective inhibitor of cathepsin L, 0.5 mg
Cathepsin L substrate	sc-3136	Z-FR-AMC, excellent substrate for cathepsin L. Also useful as a substrate for cathepsin B	Z-FR-AMC, excellent substrate for cathepsin L. Also useful as a substrate for cathepsin B, 0.5 mg
Cdc2 p34 substrate	sc-3065	Substrate
Cdk2 substrate	sc-3056	Substrate
Cdk5 substrate	sc-3066	Substrate
EGFR Substrate	sc-3049	Substrate	n/a
FC 131	sc-362738		1 mg
Fluorogenic Proteasome Substrate	sc-3128	Substrate	fluorogenic substrate for measuring the peptidase activity of the 20S proteasome, 0.5 mg/0.1 ml
Fluorogenic Proteasome Substrate	sc-3129	Substrate	fluorogenic substrate for measuring the peptidase activity of the 20S proteasome, 0.5 mg/0.1 ml
Granzyme B inhibitor	sc-3087	Ac-IETD-cho, Inhibits caspase-8 and granzyme B	Ac-IETD-cho, Inhibits caspase-8 and granzyme B, 0.5 mg/0.1 ml
GSK-3β substrate	sc-3114	Substrate	synthetic substrate for GSK-3β, 0.5 mg/0.1 ml
GSK-3β substrate (negative control)	sc-3115	Substrate	synthetic substrate for GSK-3β, 0.5 mg/0.1 ml
Insulin Receptor Substrate	sc-3048		sequence: TRDIYETDYYRK (>97% pure by HPLC)
KN-62	sc-3560	A potent, selective inhibitor of Ca²⁺calmodulin kinase II.	1 mg
Leupeptin, Hemisulfate	sc-3141	Reversible inhibitor of serine and cysteine proteases such as calpain, plasmin, trypsin, papain, and cathepsin B, no inhibition found with pepsin, cathepsins A and D, thrombin, or α-chymotrypsin; recommended starting concentration 0.5 µg/ml.	Reversible inhibitor of trypsin-like proteases and cysteine proteases., 0.5 mg/0.1 ml
MAP kinase substrate (EGFR)	sc-3013	peptide substrate for ERK 1 and ERK 2 MAP kinases, 0.5 mg/0.1 ml	peptide substrate for ERK 1 and ERK 2 MAP kinases, 0.5 mg/0.1 ml
MAP kinase substrate (MBP)	sc-3011	Substrate	peptide substrate for ERK 1 and ERK 2 MAP kinases, 0.5 mg/0.1 ml
MAPKAP Kinase-2 inhibitor	sc-3091	Inhibitor	n/a
MEK-1 substrate	sc-3014	0.5 mg/0.1 ml	tyrosine phosphorylation ª 170 µM
MYLK/MYLK2 Substrate (PG-AA)	sc-3043		synthetic substrate for MLCK, 0.5 mg/0.1 ml
MYLK2 inhibitor	sc-3045		synthetic inhibitor for MYLK2, 0.5 mg/0.1 ml
MYLK2 Substrate (L-A)	sc-3044		synthetic substrate for MYLK2, 0.5 mg/0.1 ml
Neurokinin A	sc-3138	synthetic ligand	synthetic ligand for NK-1R2, 0.5 mg/0.1 ml
Neurokinin B	sc-3139	synthetic ligand	synthetic ligand for NK-1R3, 0.5 mg/0.1 ml
Neuropeptide Y	sc-3140	Synthetic potassium channel blocker. Potent vasocon. Reversibly inhibits Ca²⁺-activated K⁺ channels in vascular smooth muscle cells.	Synthetic potassium channel blocker. Potent vasocon, 0.5 mg/0.1 ml
NFκB control	sc-3061	synthetic control	synthetic control for NFκB inhibitor, 0.5 mg/0.1 ml
NFκB inhibitor	sc-3060	Inhibitor	synthetic inhibitor for NFκB, 0.5 mg/0.1 ml
p70 S6 Rsk substrate	sc-3009	Substrate	231-239 (h)
PI 3-kinase activator	sc-3036		sequence: KKHTDDGYMPMSPGVA (>97% pure by HPLC)
PKA inhibitor	sc-3010	Inhibitor	N-terminus (h)
PLA₂ activator	sc-3034	Synthetic activator of PLA₂ derived from PLAP.	Synthetic activator of PLA₂, 0.5 mg/0.1 ml
PP2B Inhibitor	sc-3055	Inhibitor	synthetic inhibitor for PP2B, 0.5 mg/0.1 ml
PP2B Substrate (pSer 95)	sc-3053	Substrate	synthetic substrate for PP2B, 0.5 mg/0.1 ml
PP2B Substrate (Ser 95)	sc-3054	Substrate	synthetic substrate for PP2B, 0.5 mg/0.1 ml
Proteasome Inhibitor	sc-3127	Inhibitor	synthetic peptide inhibitor for proteasomes, 0.5 mg/0.1 ml
PSTAIRE peptide	sc-3142	microinjection	internal (h)
PTP1B Substrate	sc-3126	Substrate	n/a
SH2 domain binding peptide	sc-3123		sequence: TSTEPQYQPGENL (>97% pure by HPLC)
SH2 domain inhibitor	sc-3122	Inhibitor	n/a
Sos SH3 domain inhibitor	sc-3124		sequence: VPPPVPPRRR (>97% pure by HPLC)
Substance P	sc-3137		synthetic ligand for NK-1R, 0.5 mg/0.1 ml
syntide-2	sc-3015	Substrate	n/a
TC 14012	sc-362800		1 mg
Tyrosine Hydroxylase substrate	sc-3090	Substrate	n/a